Recombinant Human FLJ44635 Protein, GST-tagged

• Cat.No.: FLJ44635-4344H
• Product Overview: Human FLJ44635 full-length ORF (BAC86606.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FLJ44635 (TPT1-Like Protein) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 41.8 kDa
• AA Sequence: METVIMITYWDLISHSEMFSDSYMSQEIADGLRLEVEGKIVSRTEGNIFDSLIGGNASAEGPEGKGTESTVITGVDSVMNHHLQETSFTKEAYNKCIKDYMKSIKGKLEEQRPKRVKPFMTGAAEQIKHILANFKNYQKT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FLJ44635 TPT1-like protein [ Homo sapiens (human) ]
• Official Symbol: FLJ44635
• Synonyms: FLJ44635; TPT1-like protein; TPT1-like protein
• Gene ID: 392490
• mRNA Refseq: NM_207422
• Protein Refseq: NP_997305