Recombinant Human FKBP9L Protein, GST-tagged

• Cat.No.: FKBP9L-4200H
• Product Overview: Human FKBP9L full-length ORF ( NP_878247.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FKBP9P1 (FK506 Binding Protein 9 Pseudogene 1) is a Pseudogene.
• Molecular Mass: 42 kDa
• AA Sequence: MDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKQDEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP9P1 FK506 binding protein 9 pseudogene 1 [ Homo sapiens (human) ]
• Official Symbol: FKBP9L
• Synonyms: FKBP9P1; FK506 binding protein 9 pseudogene 1; FKBP9L; FK506 binding protein 9-like; MGC20531
• Gene ID: 360132
• UniProt ID: Q75LS8