Recombinant Human FKBP8 Protein, GST-tagged

• Cat.No.: FKBP8-4198H
• Product Overview: Human FKBP8 full-length ORF ( AAH09966, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function. [provided by RefSeq
• Molecular Mass: 64.79 kDa
• AA Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGPVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRRRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP8 FK506 binding protein 8, 38kDa [ Homo sapiens ]
• Official Symbol: FKBP8
• Synonyms: FKBP8; FK506 binding protein 8, 38kDa; FK506 binding protein 8 (38kD); peptidyl-prolyl cis-trans isomerase FKBP8; FKBP38; FKBPr38; FKBP-8; FKBP-38; hFKBP38; rotamase; 38 kDa FKBP; PPIase FKBP8; 38 kDa FK506-binding protein; FK506-binding protein 8 (38kD)
• Gene ID: 23770
• mRNA Refseq: NM_012181
• Protein Refseq: NP_036313
• MIM: 604840
• UniProt ID: Q14318