Recombinant Human FKBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FKBP7-5061H
• Product Overview: FKBP7 MS Standard C13 and N15-labeled recombinant protein (NP_851939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium.
• Molecular Mass: 25.8 kDa
• AA Sequence: MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDELSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FKBP7 FK506 binding protein 7 [ Homo sapiens (human) ]
• Official Symbol: FKBP7
• Synonyms: FKBP7; FK506 binding protein 7; peptidyl-prolyl cis-trans isomerase FKBP7; FKBP23; FKBP-7; FKBP-23; rotamase; 23 kDa FKBP; PPIase FKBP7; FK506-binding protein 7; FK506-binding protein 23; 23 kDa FK506-binding protein; PPIase; MGC9420
• Gene ID: 51661
• mRNA Refseq: NM_181342
• Protein Refseq: NP_851939
• MIM: 607062
• UniProt ID: Q9Y680