Recombinant Human FKBP14, His-tagged

Cat.No. : FKBP14-28911TH
Product Overview : Recombinant full length Human FKBP14 with an N terminal His tag; 213 amino acids with tag, MWt 24.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 192 amino acids
Description : FKBP14, also known as 22 kDa FK506-binding protein, is an enzyme that accelerates the folding of proteins during protein synthesis. This protein contains two EF-hand domains and one PPIase FKBP-type domain.
Conjugation : HIS
Molecular Weight : 24.200kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
Sequence Similarities : Contains 2 EF-hand domains.Contains 1 PPIase FKBP-type domain.
Gene Name FKBP14 FK506 binding protein 14, 22 kDa [ Homo sapiens ]
Official Symbol FKBP14
Synonyms FKBP14; FK506 binding protein 14, 22 kDa; FK506 binding protein 14 (22 kDa); peptidyl-prolyl cis-trans isomerase FKBP14; FKBP22; FLJ20731;
Gene ID 55033
mRNA Refseq NM_017946
Protein Refseq NP_060416
Uniprot ID Q9NWM8
Chromosome Location 7p15
Pathway Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Unfolded Protein Response, organism-specific biosystem;
Function FK506 binding; calcium ion binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FKBP14 Products

Required fields are marked with *

My Review for All FKBP14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon