Recombinant Human FKBP11 Protein, GST-tagged

• Cat.No.: FKBP11-4184H
• Product Overview: Human FKBP11 full-length ORF ( NP_057678.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 48.6 kDa
• AA Sequence: MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP11 FK506 binding protein 11, 19 kDa [ Homo sapiens ]
• Official Symbol: FKBP11
• Synonyms: FKBP11; FK506 binding protein 11, 19 kDa; FK506 binding protein 11 (19 kDa); peptidyl-prolyl cis-trans isomerase FKBP11; FKBP19; FKBP-11; FKBP-19; rotamase; 19 kDa FKBP; PPIase FKBP11; FK506-binding protein 11; 19 kDa FK506-binding protein; MGC54182
• Gene ID: 51303
• mRNA Refseq: NM_001143781
• Protein Refseq: NP_001137253
• MIM: 610571
• UniProt ID: Q9NYL4