Recombinant Human FKBP11 Protein, GST-tagged
Cat.No. : | FKBP11-4184H |
Product Overview : | Human FKBP11 full-length ORF ( NP_057678.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]).[supplied by OMIM |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP11 FK506 binding protein 11, 19 kDa [ Homo sapiens ] |
Official Symbol | FKBP11 |
Synonyms | FKBP11; FK506 binding protein 11, 19 kDa; FK506 binding protein 11 (19 kDa); peptidyl-prolyl cis-trans isomerase FKBP11; FKBP19; FKBP-11; FKBP-19; rotamase; 19 kDa FKBP; PPIase FKBP11; FK506-binding protein 11; 19 kDa FK506-binding protein; MGC54182; |
Gene ID | 51303 |
mRNA Refseq | NM_001143781 |
Protein Refseq | NP_001137253 |
MIM | 610571 |
UniProt ID | Q9NYL4 |
◆ Cell & Tissue Lysates | ||
FKBP11-6212HCL | Recombinant Human FKBP11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKBP11 Products
Required fields are marked with *
My Review for All FKBP11 Products
Required fields are marked with *
0
Inquiry Basket