Recombinant Human FIS1 Protein, GST-tagged

• Cat.No.: FIS1-4178H
• Product Overview: Human FIS1 full-length ORF ( AAH03540.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.46 kDa
• AA Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FIS1 fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: FIS1
• Synonyms: FIS1; fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae); fission 1 (mitochondrial outer membrane) homolog (yeast), tetratricopeptide repeat domain 11, TTC11; mitochondrial fission 1 protein; CGI 135; CGI 135 protein; Fis1; H_NH0132A01.6; hFis1; FIS1 homolog; TPR repeat protein 11; tetratricopeptide repeat domain 11; tetratricopeptide repeat protein 11; TTC11; CGI-135
• Gene ID: 51024
• mRNA Refseq: NM_016068
• Protein Refseq: NP_057152
• MIM: 609003
• UniProt ID: Q9Y3D6