Recombinant Human Fibroblast Growth Factor 2 (basic) (aa 146)
Cat.No. : | FGF2-678H |
Product Overview : | Recombinant humanFibroblast Growth Factor 2 contains 146 amino acids. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | FGF2 hasbeen hypothesized that, during both wound healing of normal tissues and tumordevelopment, the action of heparan sulfate-degrading enzymes activates bFGF,thus mediating the formation of new blood vessels, a process known asangiogenesis. |
Form : | Lyophilized from a0.2 um sterile filtered solution, carrier free. |
Purity : | >95% asdetermined by SDS-PAGE analysis. |
Molecular Weight : | 17 kDa |
Endotoxin Level : | <0.1 ng/ug ofFGF2 |
Biological Activity : | Determined by thedose-dependent proliferation of BALB/3T3 cells. The EDSO range is 0.1-1.0ng/ml. |
Specific Activity : | 1.0 x 107to 1.0 x 106 units/mg |
Amino Acid Sequence : | PALPEDGGSGIKLQLQAEERNNYNTYRSRK AFPPGHFKDPGWSIKGVCAYTSWYVALKRKRLYCKNGGFNRYLAMKEDGTGQYKLG SKT FLR旧PDGRV RLLASKCVTDGPGQKAILFL DGVREKSDPHECFFFELESPMSAKS |
Reconstitution : | Centrifuge vialprior to opening. Add sterile distilled water to the vial to fully solubilizethe protein to a concentration of 0.1-0.5 mg/ml. Further dilutions should bemade in medium or buffered solution containing carrier protein such as PBSwith 0.1%BSA. Please note that the addition of any carrier protein into thisproduct may produceunwanted endotoxin.This depends upon the particular application employed. |
Storage : | Store at -20°C to-80°C with a carrier protein (0.1%HSA or BSA) as a stabilizer for long termstorage. Please note that the addition of any carrier protein into thisproduct may produce unwanted endotoxin. This depends upon the particularapplication employed. Avoid repeated freeze-thaw cycles. |
OfficialSymbol : | FGF2 |
Gene Name | FGF2 fibroblast growth factor 2(basic) [ Homo sapiens ] |
Synonyms | FGF2; fibroblastgrowth factor 2 (basic); BFGF; FGFB; HBGF-2; heparin-binding growth factor 2; prostatropin;OTTHUMP00000037513; basic fibroblast growth factor bFGF |
Gene ID | 2247 |
mRNA Refseq | NM_002006 |
Protein Refseq | NP_001997 |
MIM | 134920 |
UniProt ID | P09038 |
Chromosome Location | 4q26 |
Pathway | Angiopoietinreceptor Tie2-mediated signaling; Downstreamsignaling of activated FGFR; EndochondralOssification; FGFR ligand binding andactivation; FGFR1 ligand binding andactivation; FGFR1b ligand binding andactivation; FRS2-mediated cascade;Glypican 1 network; IRS-mediated signalling; IRS-related events; Integrins in angiogenesis; MAPKsignaling pathway; Melanoma; PI-3K cascade; PI3KCascade |
Function | chemoattractantactivity; cytokine activity; fibroblast growth factor binding; fibroblast growthfactor receptor binding; growth factor activity; heparin binding;ligand-dependent nuclear receptor transcription coactivator activity; proteinbinding; protein tyrosine kinase activity; voltage-gated calcium channelactivity |
◆ Recombinant Proteins | ||
FGF2-678H | Recombinant Human Fibroblast Growth Factor 2 (basic) (aa 146) | +Inquiry |
FGF2-2120H | Recombinant Human FGF2 protein, Avi & His-tagged, Biotinylated | +Inquiry |
FGF2-049H | Active Recombinant Human fibroblast growth factor 2 Protein, His&Flag tagged | +Inquiry |
fgf2-08Z | Recombinant Zebrafish fgf2 Protein | +Inquiry |
Fgf2-40R | Recombinant Rat Fgf2 protein | +Inquiry |
◆ Native Proteins | ||
FGF2-26551TH | Native Human FGF2 | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
0
Inquiry Basket