Recombinant Human Fibroblast Growth Factor 2 (basic) (aa 146)

• Cat.No.: FGF2-678H
• Product Overview: Recombinant humanFibroblast Growth Factor 2 contains 146 amino acids.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: FGF2 hasbeen hypothesized that, during both wound healing of normal tissues and tumordevelopment, the action of heparan sulfate-degrading enzymes activates bFGF,thus mediating the formation of new blood vessels, a process known asangiogenesis.
• Form: Lyophilized from a0.2 um sterile filtered solution, carrier free.
• Purity: >95% asdetermined by SDS-PAGE analysis.
• Molecular Weight: 17 kDa
• Endotoxin Level: <0.1 ng/ug ofFGF2
• Biological Activity: Determined by thedose-dependent proliferation of BALB/3T3 cells. The EDSO range is 0.1-1.0ng/ml.
• Specific Activity: 1.0 x 107to 1.0 x 106 units/mg
• Amino Acid Sequence: PALPEDGGSGIKLQLQAEERNNYNTYRSRK AFPPGHFKDPGWSIKGVCAYTSWYVALKRKRLYCKNGGFNRYLAMKEDGTGQYKLG SKT FLR旧PDGRV RLLASKCVTDGPGQKAILFL DGVREKSDPHECFFFELESPMSAKS
• Reconstitution: Centrifuge vialprior to opening. Add sterile distilled water to the vial to fully solubilizethe protein to a concentration of 0.1-0.5 mg/ml. Further dilutions should bemade in medium or buffered solution containing carrier protein such as PBSwith 0.1%BSA. Please note that the addition of any carrier protein into thisproduct may produceunwanted endotoxin.This depends upon the particular application employed.
• Storage: Store at -20°C to-80°C with a carrier protein (0.1%HSA or BSA) as a stabilizer for long termstorage. Please note that the addition of any carrier protein into thisproduct may produce unwanted endotoxin. This depends upon the particularapplication employed. Avoid repeated freeze-thaw cycles.
• OfficialSymbol: FGF2

Gene Information

• Gene Name: FGF2 fibroblast growth factor 2(basic) [ Homo sapiens ]
• Synonyms: FGF2; fibroblastgrowth factor 2 (basic); BFGF; FGFB; HBGF-2; heparin-binding growth factor 2; prostatropin;OTTHUMP00000037513; basic fibroblast growth factor bFGF
• Gene ID: 2247
• mRNA Refseq: NM_002006
• Protein Refseq: NP_001997
• MIM: 134920
• UniProt ID: P09038
• Chromosome Location: 4q26
• Pathway: Angiopoietinreceptor Tie2-mediated signaling; Downstreamsignaling of activated FGFR; EndochondralOssification; FGFR ligand binding andactivation; FGFR1 ligand binding andactivation; FGFR1b ligand binding andactivation; FRS2-mediated cascade;Glypican 1 network; IRS-mediated signalling; IRS-related events; Integrins in angiogenesis; MAPKsignaling pathway; Melanoma; PI-3K cascade; PI3KCascade
• Function: chemoattractantactivity; cytokine activity; fibroblast growth factor binding; fibroblast growthfactor receptor binding; growth factor activity; heparin binding;ligand-dependent nuclear receptor transcription coactivator activity; proteinbinding; protein tyrosine kinase activity; voltage-gated calcium channelactivity