Recombinant Human FIBIN Protein, GST-tagged

• Cat.No.: FIBIN-4167H
• Product Overview: Human FIBIN full-length ORF ( NP_976249.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FIBIN (Fin Bud Initiation Factor Homolog (Zebrafish)) is a Protein Coding gene. Diseases associated with FIBIN include Wilson-Turner Syndrome.
• Molecular Mass: 50.7 kDa
• AA Sequence: MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FIBIN fin bud initiation factor homolog (zebrafish) [ Homo sapiens (human) ]
• Official Symbol: FIBIN
• Synonyms: FIBIN; fin bud initiation factor homolog (zebrafish); fin bud initiation factor homolog; Fin Bud Initiation Factor Homolog (Zebrafish)
• Gene ID: 387758
• mRNA Refseq: NM_203371
• Protein Refseq: NP_976249
• MIM: 617085
• UniProt ID: Q8TAL6