Recombinant Human FHOD1 Protein, GST-tagged

• Cat.No.: FHOD1-4166H
• Product Overview: Human FHOD1 partial ORF ( NP_037373.1, 2 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which is a member of the formin/diaphanous family of proteins. The gene is ubiquitously expressed but is found in abundance in the spleen. The encoded protein has sequence homology to diaphanous and formin proteins within the Formin Homology (FH)1 and FH2 domains. It also contains a coiled-coil domain, a collagen-like domain, two nuclear localization signals, and several potential PKC and PKA phosphorylation sites. It is a predominantly cytoplasmic protein and is expressed in a variety of human cell lines. [provided by RefSeq
• Molecular Mass: 36.52 kDa
• AA Sequence: AGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FHOD1 formin homology 2 domain containing 1 [ Homo sapiens ]
• Official Symbol: FHOD1
• Synonyms: FHOD1; formin homology 2 domain containing 1; FH1/FH2 domain-containing protein 1; FHOS; formin homolog overexpressed in spleen 1
• Gene ID: 29109
• mRNA Refseq: NM_013241
• Protein Refseq: NP_037373
• MIM: 606881
• UniProt ID: Q9Y613