Recombinant Human FHL5 Protein, GST-tagged

• Cat.No.: FHL5-4165H
• Product Overview: Human FHL5 full-length ORF ( AAH21723, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. [provided by RefSeq
• Molecular Mass: 56.98 kDa
• AA Sequence: MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FHL5 four and a half LIM domains 5 [ Homo sapiens ]
• Official Symbol: FHL5
• Synonyms: FHL5; four and a half LIM domains 5; four and a half LIM domains protein 5; ACT; dJ393D12.2; FLJ33049; FHL-5; 1700027G07Rik; LIM protein ACT; activator of CREM in testis; activator of cAMP-responsive element modulator in testis; activator of cAMP-responsive element modulator (CREM) in testis; RP3-393D12.2; KIAA0776
• Gene ID: 9457
• mRNA Refseq: NM_001170807
• Protein Refseq: NP_001164278
• MIM: 605126
• UniProt ID: Q5TD97