Recombinant Human FGFR1 protein, T7/His-tagged

• Cat.No.: FGFR1-111H
• Product Overview: Recombinant human extracellular domain of CD331 cDNA ( 22 – 376 aa, Isoform-1, derived from BC018128 ) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 22-376 a.a.
• Form: 1.0 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFRPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWL RDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETD NTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIM DSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKH IEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPA VMTSPLYLE
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro CD331 mediated FGF growth factor pathway regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD331 protein-protein interaction assay.3. Potential diagnostic biomarker for cancer and artery diseases.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: FGFR1 fibroblast growth factor receptor 1 [ Homo sapiens ]
• Official Symbol: FGFR1
• Synonyms: FGFR1; fibroblast growth factor receptor 1; FLT2, fms related tyrosine kinase 2 , KAL2; BFGFR; CD331; CEK; FLG; H2; H3; H4; H5; N SAM; Pfeiffer syndrome; FGFR1/PLAG1 fusion; proto-oncogene c-Fgr; FMS-like tyrosine kinase 2; hydroxyaryl-protein kinase; fm
• Gene ID: 2260
• mRNA Refseq: NM_001174063
• Protein Refseq: NP_001167534
• MIM: 136350
• UniProt ID: P11362
• Chromosome Location: 8p12
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem
• Function: ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein ho