Recombinant Human FGF7, StrepII-tagged

Cat.No. : FGF7-218H
Product Overview : Purified, full-length human recombinant Fibroblast growth factor 7 or FGF7 protein (amino acids 32-194, 163 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.9 kDa. (Accession NP_002000.1; UniProt P21781)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 32-194, 163 a.a.
Description : FGF7 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth. and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development, and early lung organogenesis.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVG IVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKK EQKTAHFLPMAIT
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name FGF7 fibroblast growth factor 7 [ Homo sapiens ]
Official Symbol FGF7
Synonyms FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7;
Gene ID 2252
mRNA Refseq NM_002009
Protein Refseq NP_002000
MIM 148180
UniProt ID P21781
Chromosome Location 15q21.2
Pathway Downstream signaling of activated FGFR, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem; FGFR2b ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem; Glypican 3 network, organism-specific biosystem; IRS-mediated signalling, organism-specific biosystem;
Function chemoattractant activity; growth factor activity; heparin binding; type 2 fibroblast growth factor receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF7 Products

Required fields are marked with *

My Review for All FGF7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon