Recombinant Human FGF7 protein, His-B2M-tagged
Cat.No. : | FGF7-2913H |
Product Overview : | Recombinant Human FGF7 protein(P21781)(34-189aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 34-189aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | DMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FGF7 fibroblast growth factor 7 [ Homo sapiens ] |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7; |
Gene ID | 2252 |
mRNA Refseq | NM_002009 |
Protein Refseq | NP_002000 |
MIM | 148180 |
UniProt ID | P21781 |
◆ Recombinant Proteins | ||
FGF7-3020H | Recombinant Human FGF7 Protein (Thr23-Thr216), C-His tagged | +Inquiry |
FGF7-410H | Active Recombinant Human FGF7 Protein | +Inquiry |
FGF7-229F | Active Recombinant Human FGF7 Protein | +Inquiry |
FGF7-682H | Recombinant Human Fibroblast Growth Factor 7, His-tagged | +Inquiry |
FGF7-5856M | Recombinant Mouse FGF7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *
0
Inquiry Basket