Recombinant Human FGF7 Protein

• Cat.No.: FGF7-057H
• Product Overview: Recombinant human FGF7 protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 194
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis.
• Form: Lyophilized
• Molecular Mass: 18.995 kDa
• AA Sequence: MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
• Purity: > 97%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: 4°C
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst).
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: FGF7 fibroblast growth factor 7 [ Homo sapiens (human) ]
• Official Symbol: FGF7
• Synonyms: FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7
• Gene ID: 2252
• mRNA Refseq: NM_002009
• Protein Refseq: NP_002000
• MIM: 148180
• UniProt ID: P21781