Recombinant Human FGF2, StrepII-tagged
Cat.No. : | FGF2-293H |
Product Overview : | Purified, full-length human recombinant bFGF (FGF2) protein (amino acids 2-288, 287 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 30.6 kDa. (Accession NP_001997.5; UniProt P09038) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 2-288, 287 a.a. |
Description : | FGF2 is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. It plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration, and has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | VGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSG SRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGS GAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLA SKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | 85% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month. |
Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2; |
Gene ID | 2247 |
mRNA Refseq | NM_002006 |
Protein Refseq | NP_001997 |
MIM | 134920 |
UniProt ID | P09038 |
Chromosome Location | 4q26 |
Pathway | Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1b ligand binding and activation, organism-specific biosystem; FGFR1c ligand binding and activation, organism-specific biosystem; |
Function | chemoattractant activity; cytokine activity; fibroblast growth factor binding; fibroblast growth factor receptor binding; growth factor activity; heparin binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein tyrosine kinase activity; voltage-gated calcium channel activity; |
◆ Recombinant Proteins | ||
FGF2-039H | Recombinant Human FGF2 Protein | +Inquiry |
FGF2-6983C | Recombinant Chicken FGF2 | +Inquiry |
FGF2-25H | Active Recombinant Human FGF2 Protein (Formulation I- Carrier Free-Lyophilized, 134-288, 154 amino acid) | +Inquiry |
FGF2-754H | Active Recombinant Human FGF2 protein | +Inquiry |
FGF2-18H | Active Recombinant Human FGF2 Protein (143-288aa), Non-tagged | +Inquiry |
◆ Native Proteins | ||
FGF2-26551TH | Native Human FGF2 | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
0
Inquiry Basket