Recombinant Human FGF17 Protein, GST-tagged
Cat.No. : | FGF17-4106H |
Product Overview : | Human FGF17 full-length ORF (1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was shown to be prominently expressed in the cerebellum and cortex. The mouse homolog of this gene was localized to specific sites in the midline structures of the forebrain, the midbrain-hindbrain junction, developing skeleton and developing arteries, which suggests a role in central nervous system, bone and vascular development. This gene was referred to as FGF-13 in reference 2, however, its amino acid sequence and chromosomal localization are identical to FGF17. [provided by RefSeq |
Molecular Mass : | 54.1 kDa |
AA Sequence : | MAICPLHSAGQVACPHYIHLLTPLPWMDQWWCHPKQIDTIFPLVTAKGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF17 fibroblast growth factor 17 [ Homo sapiens ] |
Official Symbol | FGF17 |
Synonyms | FGF17; fibroblast growth factor 17; FGF 13; FGF-17; FGF-13; |
Gene ID | 8822 |
mRNA Refseq | NM_003867 |
Protein Refseq | NP_003858 |
MIM | 603725 |
UniProt ID | O60258 |
◆ Recombinant Proteins | ||
Fgf17-5667M | Recombinant Mouse Fgf17 Protein (Thr23-Thr216), C-His tagged | +Inquiry |
FGF17-5845M | Recombinant Mouse FGF17 Protein | +Inquiry |
FGF17-74H | Recombinant Active Human FGF17 Protein, His-tagged(N-ter) | +Inquiry |
FGF17-1481H | Recombinant Human FGF17 Protein, His-tagged | +Inquiry |
FGF17-4106H | Recombinant Human FGF17 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF17-6245HCL | Recombinant Human FGF17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF17 Products
Required fields are marked with *
My Review for All FGF17 Products
Required fields are marked with *
0
Inquiry Basket