Recombinant Human FGF16 protein

• Cat.No.: FGF16-168H
• Product Overview: Recombinant Human FGF16 protein was expressed in Escherichia coli.

Specification

• Description: Fibroblast growth factor 16 (FGF-16) belongs to the large FGF family. All FGF family members are heparin-binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. FGF-16 was originally identified in rat heart tissue by homology based polymerase chain reaction. Human FGF-16 cDNA predicts a 207 aa precursor protein with one N-linked glycosylation site. FGF-16 lacks a typical signal peptide, but is efficiently generated by mechanisms other than the classical protein secretion pathway. Among FGF family members, FGF-16 is most similar to FGF-9, sharing 73% aa sequence homology. Human FGF-16 shares 99% and 98.6% aa sequence identity with the mouse and rat FGF-16, respectively.
• Source: E.coli
• Species: Human
• Form: Supplied as a 0.2μm filtered solution in 20 mM Tris-HCl, 1 M NaCl, pH 9.0, with 0.02 % Tween-20, 10 % Glycerol.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 23.6 kDa, a single non-glycosylated polypeptide chain containing 206 amino acids.
• Protein length: 206
• AA Sequence: AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
• Endotoxin: Less than 0.1 EU/µg of rHuFGF-16 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
• Tag: Non

Gene Information

• Gene Name: FGF16
• Official Symbol: FGF16
• Synonyms: FGF16; fibroblast growth factor 16; FGF-16
• Gene ID: 8823
• mRNA Refseq: NM_003868
• Protein Refseq: NP_003859
• MIM: 300827
• UniProt ID: O43320