Recombinant Human FGF16 protein
Cat.No. : | FGF16-168H |
Product Overview : | Recombinant Human FGF16 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 206 |
Description : | Fibroblast growth factor 16 (FGF-16) belongs to the large FGF family. All FGF family members are heparin-binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. FGF-16 was originally identified in rat heart tissue by homology based polymerase chain reaction. Human FGF-16 cDNA predicts a 207 aa precursor protein with one N-linked glycosylation site. FGF-16 lacks a typical signal peptide, but is efficiently generated by mechanisms other than the classical protein secretion pathway. Among FGF family members, FGF-16 is most similar to FGF-9, sharing 73% aa sequence homology. Human FGF-16 shares 99% and 98.6% aa sequence identity with the mouse and rat FGF-16, respectively. |
Form : | Supplied as a 0.2μm filtered solution in 20 mM Tris-HCl, 1 M NaCl, pH 9.0, with 0.02 % Tween-20, 10 % Glycerol. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 23.6 kDa, a single non-glycosylated polypeptide chain containing 206 amino acids. |
AA Sequence : | AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR |
Endotoxin : | Less than 0.1 EU/µg of rHuFGF-16 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
Gene Name | FGF16 |
Official Symbol | FGF16 |
Synonyms | FGF16; fibroblast growth factor 16; FGF-16; |
Gene ID | 8823 |
mRNA Refseq | NM_003868 |
Protein Refseq | NP_003859 |
MIM | 300827 |
UniProt ID | O43320 |
◆ Recombinant Proteins | ||
FGF16-3225H | Recombinant Human FGF16 Protein (Asn35-Arg207), N-His tagged | +Inquiry |
FGF16-4813HF | Recombinant Full Length Human FGF16 Protein, GST-tagged | +Inquiry |
FGF16-3442C | Recombinant Chicken FGF16 | +Inquiry |
FGF16-1518R | Recombinant Rhesus Macaque FGF16 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF16-740H | Active Recombinant Human, Cynomolgus FGF16 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF16 Products
Required fields are marked with *
My Review for All FGF16 Products
Required fields are marked with *
0
Inquiry Basket