Recombinant Human FGF14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FGF14-2246H
• Product Overview: FGF14 MS Standard C13 and N15-labeled recombinant protein (NP_004106) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: 27.5 kDa
• AA Sequence: MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FGF14 fibroblast growth factor 14 [ Homo sapiens (human) ]
• Official Symbol: FGF14
• Synonyms: FGF14; fibroblast growth factor 14; FHF4; SCA27; bA397O8.2; fibroblast growth factor homologous factor 4; FHF-4; FGF-14; MGC119129
• Gene ID: 2259
• mRNA Refseq: NM_004115
• Protein Refseq: NP_004106
• MIM: 601515
• UniProt ID: Q92915