Recombinant Human FGB Protein, GST-tagged
Cat.No. : | FGB-4088H |
Product Overview : | Human FGB partial ORF ( NP_005132, 392 a.a. - 491 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGB fibrinogen beta chain [ Homo sapiens ] |
Official Symbol | FGB |
Synonyms | FGB; fibrinogen beta chain; fibrinogen, B beta polypeptide; MGC104327; MGC120405; |
Gene ID | 2244 |
mRNA Refseq | NM_001184741 |
Protein Refseq | NP_001171670 |
MIM | 134830 |
UniProt ID | P02675 |
◆ Recombinant Proteins | ||
FGB-3532C | Recombinant Cat FGB protein(1-20aa), His-KSI-tagged | +Inquiry |
Fgb-5819M | Recombinant Mouse Fgb protein, His-tagged | +Inquiry |
FGB-5654H | Recombinant Horse FGB protein | +Inquiry |
Fgb-1479R | Recombinant Rat Fgb Protein, His-tagged | +Inquiry |
FGB-4008C | Recombinant Chicken FGB | +Inquiry |
◆ Native Proteins | ||
FGB-43D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
FGB-35D | Native Canine Fibrinogen | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGB-6255HCL | Recombinant Human FGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGB Products
Required fields are marked with *
My Review for All FGB Products
Required fields are marked with *
0
Inquiry Basket