Recombinant Human FCRL4 protein, His-tagged

• Cat.No.: FCRL4-920H
• Product Overview: Recombinant Human FCRL4(20-387aa) fused with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 20-387aa
• Description: This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains three immune-receptor tyrosine-based inhibitory motifs. This protein may play a role in the function of memory B-cells in the epithelia. Aberrations in the chromosomal region encoding this gene are associated with non-Hodgkin lymphoma and multiple myeloma
• Form: 20mM Tris-HCl based buffer,pH8.0
• Molecular Mass: 48.68kDa
• AA Sequence: AHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRE SGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWN GNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATD SQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSY WCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDT TFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNVTVRE TPGNRDGL
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.

Gene Information

• Gene Name: FCRL4 Fc receptor-like 4 [ Homo sapiens ]
• Official Symbol: FCRL4
• Synonyms: FCRL4; Fc receptor-like 4; Fc receptor-like protein 4; CD307d; FCRH4; IGFP2; IRTA1; hIFGP2; fcR-like protein 4; IFGP family protein 2; fc receptor homolog 4; immunoglobulin superfamily Fc receptor, gp42; immune receptor translocation-associated protein 1; immunoglobulin superfamily receptor translocation associated 1; MGC150522; MGC150523
• Gene ID: 83417
• mRNA Refseq: NM_031282
• Protein Refseq: NP_112572
• MIM: 605876
• UniProt ID: Q96PJ5
• Chromosome Location: 1q21
• Function: protein binding; receptor activity