Recombinant Human FCRL3 Protein, GST-tagged

Cat.No. : FCRL3-4009H
Product Overview : Human FCRL3 partial ORF ( NP_001019838, 625 a.a. - 723 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Molecular Mass : 36.63 kDa
AA Sequence : SRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FCRL3 Fc receptor-like 3 [ Homo sapiens ]
Official Symbol FCRL3
Synonyms FCRL3; Fc receptor-like 3; Fc receptor-like protein 3; CD307c; FCRH3; IFGP3; IRTA3; SPAP2; SPAP2a; SPAP2b; SPAP2c; SPAP2d; SPAP2e; hIFGP3; fcR-like protein 3; Fc receptor homolog 3; IFGP family protein 3; SH2 domain-containing phosphatase anchor protein 2; immune receptor translocation-associated protein 3; immunoglobulin superfamily receptor translocation associated protein 3;
Gene ID 115352
mRNA Refseq NM_052939
Protein Refseq NP_443171
MIM 606510
UniProt ID Q96P31

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FCRL3 Products

Required fields are marked with *

My Review for All FCRL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon