Recombinant Human FCRL3 Protein, GST-tagged
Cat.No. : | FCRL3-4009H |
Product Overview : | Human FCRL3 partial ORF ( NP_001019838, 625 a.a. - 723 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCRL3 Fc receptor-like 3 [ Homo sapiens ] |
Official Symbol | FCRL3 |
Synonyms | FCRL3; Fc receptor-like 3; Fc receptor-like protein 3; CD307c; FCRH3; IFGP3; IRTA3; SPAP2; SPAP2a; SPAP2b; SPAP2c; SPAP2d; SPAP2e; hIFGP3; fcR-like protein 3; Fc receptor homolog 3; IFGP family protein 3; SH2 domain-containing phosphatase anchor protein 2; immune receptor translocation-associated protein 3; immunoglobulin superfamily receptor translocation associated protein 3; |
Gene ID | 115352 |
mRNA Refseq | NM_052939 |
Protein Refseq | NP_443171 |
MIM | 606510 |
UniProt ID | Q96P31 |
◆ Recombinant Proteins | ||
FCRL3-1716R | Recombinant Rhesus Monkey FCRL3 Protein, hIgG1-tagged | +Inquiry |
FCRL3-12830H | Recombinant Human FCRL3, His-tagged | +Inquiry |
FCRL3-1717R | Recombinant Rhesus Monkey FCRL3 Protein, hIgG4-tagged | +Inquiry |
FCRL3-2939H | Recombinant Human FCRL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCRL3-795H | Active Recombinant Human FCRL3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCRL3 Products
Required fields are marked with *
My Review for All FCRL3 Products
Required fields are marked with *
0
Inquiry Basket