Recombinant Human FCRL2 Protein, GST-tagged
Cat.No. : | FCRL2-4008H |
Product Overview : | Human FCRL2 partial ORF ( NP_110391, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Apr 2009] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCRL2 Fc receptor-like 2 [ Homo sapiens ] |
Official Symbol | FCRL2 |
Synonyms | FCRL2; Fc receptor-like 2; SH2 domain containing phosphatase anchor protein 1 , SPAP1; Fc receptor-like protein 2; CD307b; FCRH2; IRTA4; fcR-like protein 2; IFGP family protein 4; fc receptor homolog 2; immunoglobulin superfamily Fc receptor, gp42; SH2 domain containing phosphatase anchor protein 1; SH2 domain-containing phosphatase anchor protein 1; immune receptor translocation-associated protein 4; immunoglobulin receptor translocation-associated protein 4; IFGP4; SPAP1; SPAP1A; SPAP1B; SPAP1C; |
Gene ID | 79368 |
mRNA Refseq | NM_030764 |
Protein Refseq | NP_110391 |
MIM | 606509 |
UniProt ID | Q96LA5 |
◆ Recombinant Proteins | ||
FCRL2-3690C | Recombinant Chicken FCRL2 | +Inquiry |
FCRL2-1714R | Recombinant Rhesus Monkey FCRL2 Protein, hIgG4-tagged | +Inquiry |
FCRL2-497H | Active Recombinant Human Fc Receptor-Like 2, His-tagged | +Inquiry |
FCRL2-2938H | Recombinant Human FCRL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCRL2-750H | Recombinant Human FCRL2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCRL2-6275HCL | Recombinant Human FCRL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCRL2 Products
Required fields are marked with *
My Review for All FCRL2 Products
Required fields are marked with *
0
Inquiry Basket