Recombinant Human FCRL2 Protein, GST-tagged

• Cat.No.: FCRL2-4008H
• Product Overview: Human FCRL2 partial ORF ( NP_110391, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Apr 2009]
• Molecular Mass: 37.84 kDa
• AA Sequence: MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCRL2 Fc receptor-like 2 [ Homo sapiens ]
• Official Symbol: FCRL2
• Synonyms: FCRL2; Fc receptor-like 2; SH2 domain containing phosphatase anchor protein 1 , SPAP1; Fc receptor-like protein 2; CD307b; FCRH2; IRTA4; fcR-like protein 2; IFGP family protein 4; fc receptor homolog 2; immunoglobulin superfamily Fc receptor, gp42; SH2 domain containing phosphatase anchor protein 1; SH2 domain-containing phosphatase anchor protein 1; immune receptor translocation-associated protein 4; immunoglobulin receptor translocation-associated protein 4; IFGP4; SPAP1; SPAP1A; SPAP1B; SPAP1C
• Gene ID: 79368
• mRNA Refseq: NM_030764
• Protein Refseq: NP_110391
• MIM: 606509
• UniProt ID: Q96LA5