Recombinant Human FCGR2B Protein, GST-tagged
Cat.No. : | FCGR2B-3994H |
Product Overview : | Human FCGR2B partial ORF ( AAH31992, 45 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCGR2B Fc fragment of IgG, low affinity IIb, receptor (CD32) [ Homo sapiens ] |
Official Symbol | FCGR2B |
Synonyms | FCGR2B; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32) , FCG2, FCGR2; low affinity immunoglobulin gamma Fc region receptor II-b; CD32; CD32B; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); FCG2; FCGR2; IGFR2; |
Gene ID | 2213 |
mRNA Refseq | NM_001002273 |
Protein Refseq | NP_001002273 |
MIM | 604590 |
UniProt ID | P31994 |
◆ Recombinant Proteins | ||
FCGR2B-650H | Active Recombinant Human FCGR2B Protein, His-tagged | +Inquiry |
FCGR2B-1077HFL | Recombinant Full Length Human FCGR2B Protein, C-Flag-tagged | +Inquiry |
FCGR2B-323H | Recombinant Human FCGR2B protein, His-Avi-tagged | +Inquiry |
FCGR2B-1676R | Recombinant Rhesus monkey FCGR2B Protein, His-tagged | +Inquiry |
Fcgr2b-7143R | Recombinant Rat Fcgr2b protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2B-001HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
FCGR2B-1942RCL | Recombinant Rat FCGR2B cell lysate | +Inquiry |
FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGR2B Products
Required fields are marked with *
My Review for All FCGR2B Products
Required fields are marked with *
0
Inquiry Basket