Recombinant Human FCGR1A protein, GST-tagged

• Cat.No.: FCGR1A-301311H
• Product Overview: Recombinant Human FCGR1A (311-374 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Val311-Thr374
• AA Sequence: VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: FCGR1A Fc fragment of IgG, high affinity Ia, receptor (CD64) [ Homo sapiens ]
• Official Symbol: FCGR1A
• Synonyms: FCGR1A; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); high affinity immunoglobulin gamma Fc receptor I; CD64; CD64A; fcgammaRIa; Fc-gamma RI; fc-gamma RIA; Fc gamma receptor; IgG Fc receptor I; Fc-gamma receptor I A1; FCRI; IGFR1; FLJ18345
• Gene ID: 2209
• mRNA Refseq: NM_000566
• Protein Refseq: NP_000557
• MIM: 146760
• UniProt ID: P12314