Recombinant Human FCER1G, GST-tagged

• Cat.No.: FCER1G-196H
• Product Overview: Recombinant Human FCER1G(1 a.a. - 86 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Description: The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.1 kDa
• AA Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQET YETLKHEKPPQ
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [ Homo sapiens (human) ]
• Official Symbol: FCER1G
• Synonyms: FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG
• Gene ID: 2207
• mRNA Refseq: NM_004106
• Protein Refseq: NP_004097
• MIM: 147139
• UniProt ID: P30273
• Chromosome Location: 1q23
• Pathway: Fc epsilon RI signaling pathway; Fc epsilon receptor (FCERI) signaling; GPVI-mediated activation cascade; Innate Immune System
• Function: IgE binding; IgE receptor activity; IgG binding; protein binding