Recombinant Human FCER1A Protein, His-SUMO-tagged

• Cat.No.: FCER1A-1209H
• Product Overview: Recombinant Human FCER1A Protein (26-205aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 26-205 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 37.0 kDa
• AA Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQH
  QQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITN
  ATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens ]
• Official Symbol: FCER1A
• Synonyms: FCER1A; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; FCE1A; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide; FcERI
• Gene ID: 2205
• mRNA Refseq: NM_002001
• Protein Refseq: NP_001992
• MIM: 147140
• UniProt ID: P12319