Recombinant Human FCAMR Protein, GST-tagged

• Cat.No.: FCAMR-3980H
• Product Overview: Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FCAMR (Fc Fragment Of IgA And IgM Receptor) is a Protein Coding gene. Among its related pathways are Cell surface interactions at the vascular wall and CD40/CD40L signaling. GO annotations related to this gene include transmembrane signaling receptor activity and IgM binding. An important paralog of this gene is PIGR.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.62 kDa
• AA Sequence: TLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQLSPDDIGC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCAMR Fc fragment of IgA and IgM receptor [ Homo sapiens (human) ]
• Official Symbol: FCAMR
• Synonyms: FCAMR; Fc fragment of IgA and IgM receptor; Fc Fragment Of IgA And IgM Receptor; Fc Receptor, IgA, IgM, High Affinity; Fc Alpha/Mu Receptor; High Affinity Immunoglobulin Alpha And Immunoglobulin Mu Fc Receptor; Receptor For Fc Fragment Of IgA And IgM; Immunity Related Factor; CD351 Antigen; FCA/MR; FKSG87; CD351; high affinity immunoglobulin alpha and immunoglobulin mu Fc receptor; Fc alpha/mu receptor; Fc receptor, IgA, IgM, high affinity; immunity related factor; receptor for Fc fragment of IgA and IgM
• Gene ID: 83953
• mRNA Refseq: NM_001122979
• Protein Refseq: NP_001116451
• MIM: 605484
• UniProt ID: Q8WWV6