Recombinant Human FAS protein

• Cat.No.: FAS-26332TH
• Product Overview: Recombinant Human FAS protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 157
• Description: Fas and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD followed by processing of the pro-enzyme to active forms. These active caspases then cleave various cellular substrates leading to the eventual cell death. sFasR is capable of inhibiting FasL-induced apoptosis by acting as a decoy receptor that serves as a sink for FasL.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cytotoxicity of Jurkat cells is between 10-15 µg/ml in the presence of 2 ng/ml of rHuFas Ligand.
• Molecular Mass: Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 157 amino acids.
• AA Sequence: RLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN
• Endotoxin: Less than 1 EU/μg of rHusFasR/TNFRSF6 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: FAS
• Official Symbol: FAS
• Synonyms: FAS; Fas (TNF receptor superfamily, member 6); APT1, FAS1, TNFRSF6, tumor necrosis factor receptor superfamily, member 6; tumor necrosis factor receptor superfamily member 6; APO 1; CD95; Fas AMA; FAS 827dupA; CD95 antigen; FASLG receptor; apoptosis antigen 1; Delta Fas/APO-1/CD95; APO-1 cell surface antigen; apoptosis-mediating surface antigen FAS; tumor necrosis factor receptor superfamily, member 6; APT1; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
• Gene ID: 355
• mRNA Refseq: NM_000043
• Protein Refseq: NP_000034
• MIM: 134637
• UniProt ID: P25445