Recombinant Human FAM57B Protein, GST-tagged

• Cat.No.: FAM57B-3781H
• Product Overview: Human FAM57B full-length ORF (AAH07892.2, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a transmembrane protein, which may be a likely target of peroxisome proliferator-activated receptor gamma (PPAR-gamma). The product of the orthologous gene in mouse is related to obesity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
• Molecular Mass: 51.04 kDa
• AA Sequence: MASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMVLVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQYKQQHTLLHKVNGALMLLSFLCCRVLLFPYLYWAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWPRSRPPPACQAQD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM57B family with sequence similarity 57, member B [ Homo sapiens ]
• Official Symbol: FAM57B
• Synonyms: FP1188; FAM57B; family with sequence similarity 57, member B; Family With Sequence Similarity 57 Member B; Family With Sequence Similarity 57, Member B; Protein FAM57B
• Gene ID: 83723
• mRNA Refseq: NM_031478
• Protein Refseq: NP_113666
• MIM: 615175
• UniProt ID: Q71RH2