Recombinant Human FAM226B Protein, GST-tagged

Cat.No. : FAM226B-4621H
Product Overview : Human hCG_1731871 full-length ORF ( ABM85753.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM226B (Family With Sequence Similarity 226 Member B (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class.
Molecular Mass : 37.29 kDa
AA Sequence : MLKYVIKRYRSFLPEIFKKASDLPELVFGFYLKELDPAEHSYVLIRKIDPALVWGLTGDQGTPKTRLLMITLDSIFMQASCVPEEVVWEVLRVLEAHFV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM226B family with sequence similarity 226 member B (non-protein coding) [ Homo sapiens (human) ]
Official Symbol FAM226B
Synonyms FAM226B; family with sequence similarity 226 member B (non-protein coding); CXorf50B; LINC00246B; NCRNA00246B; hCG1731871; long intergenic non-protein coding RNA 246B; non-protein coding RNA 246B
Gene ID 653687

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM226B Products

Required fields are marked with *

My Review for All FAM226B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon