Recombinant Human FAM129B Protein, GST-tagged

• Cat.No.: FAM129B-3701H
• Product Overview: Human FAM129B full-length ORF ( AAH67366.1, 1 a.a. - 526 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM129B (Family With Sequence Similarity 129 Member B) is a Protein Coding gene. Among its related pathways are MAP Kinase Signaling. An important paralog of this gene is FAM129A.
• Molecular Mass: 87.1 kDa
• AA Sequence: MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTEVRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKYDYDSSSVRKRFFREALLQISIPFLLKKLAPTCKSVSSPHLLQPFGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM129B family with sequence similarity 129, member B [ Homo sapiens ]
• Official Symbol: FAM129B
• Synonyms: FAM129B; family with sequence similarity 129, member B; C9orf88, chromosome 9 open reading frame 88; niban-like protein 1; bA356B19.6; DKFZP434H0820; FLJ13518; FLJ22151; FLJ22298; MINERVA; melanoma invasion by ERK; OC58; MEG-3; C9orf88
• Gene ID: 64855
• mRNA Refseq: NM_001035534
• Protein Refseq: NP_001030611
• MIM: 614045
• UniProt ID: Q96TA1