Recombinant Human FAM103A1 Protein, GST-tagged

• Cat.No.: FAM103A1-3664H
• Product Overview: Human FAM103A1 full-length ORF (1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM103A1 (Family With Sequence Similarity 103 Member A1) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and RNA binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.38 kDa
• AA Sequence: MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM103A1 family with sequence similarity 103, member A1 [ Homo sapiens ]
• Official Symbol: FAM103A1
• Synonyms: RAM; C15orf18; HsT19360; FAM103A1; family with sequence similarity 103, member A1
• Gene ID: 83640
• mRNA Refseq: NM_031452
• Protein Refseq: NP_113640
• MIM: 614547
• UniProt ID: Q9BTL3