Recombinant Human FADS2 protein, His-SUMO-tagged

• Cat.No.: FADS2-2882H
• Product Overview: Recombinant Human FADS2 protein(O95864)(1-131aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-131aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.9 kDa
• AA Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: FADS2 fatty acid desaturase 2 [ Homo sapiens ]
• Official Symbol: FADS2
• Synonyms: FADS2; fatty acid desaturase 2; LLCDL2; D6D; delta 6 desaturase; DES6; FADSD6; SLL0262; TU13; delta-6 desaturase; delta-6-desaturase; delta(6) desaturase; delta-6 fatty acid desaturase; delta(6) fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 2
• Gene ID: 9415
• mRNA Refseq: NM_004265
• Protein Refseq: NP_004256
• MIM: 606149
• UniProt ID: O95864