Recombinant Human FADS1 protein, GST-tagged

• Cat.No.: FADS1-28817H
• Product Overview: Recombinant Human FADS1(1 a.a. - 444 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 444 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 74.47 kDa
• AA Sequence: MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFH INKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANHVFFLLYLLHILLLDGAAWLTL WVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNC FRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPSALLPLYFQWYIFYFVIQRKKWVDLAWMI TFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQLQATCNVHKSAFNDWF SGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLSAFADIIHSLKESGQLWLDAYLHQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: FADS1 fatty acid desaturase 1 [ Homo sapiens ]
• Official Symbol: FADS1
• Synonyms: FADS1; fatty acid desaturase 1; LLCDL1; D5D; delta 5 desaturase; FADS6; FADSD5; TU12; delta-5 desaturase; delta(5) desaturase; delta-5 fatty acid desaturase; delta(5) fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 1; FLJ38956; FLJ90273
• Gene ID: 3992
• mRNA Refseq: NM_013402
• Protein Refseq: NP_037534
• MIM: 606148
• UniProt ID: O60427
• Chromosome Location: 11q12-q13.1
• Pathway: Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem
• Function: C-5 sterol desaturase activity; heme binding; oxidoreductase activity