Recombinant Human FABP6 Protein, His-tagged

Cat.No. : FABP6-3676H
Product Overview : Recombinant Human FABP6 protein with N-Terminal His-tag (10 extra AA) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 15.5 kDa (calculated)
AA Sequence : MKHHHHHHASAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Endotoxin : <1.0 EU/μg
Purity : Purity as determined by densitometric image analysis: >95%
Applications : WB, ELISA
Quality Control Test : BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
LAL to determine quantity of endotoxin.
Notes : This product is intended for research use only.
Storage : Store lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
Storage Buffer : Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4
Reconstitution : Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
Gene Name FABP6 fatty acid binding protein 6 [ Homo sapiens (human) ]
Official Symbol FABP6
Synonyms FABP6; GT; Fatty acid-binding protein 6; Ileal lipid-binding protein; ILBP; Intestinal 15 kDa protein; I-15P; Intestinal bile acid-binding protein; I-BABP; ILBP; ILLBP; fatty acid binding protein 6; gastrotropin; fatty acid binding protein 6, ileal; ileal bile acid binding protein; ileal lipid-binding protein; illeal lipid-binding protein; intestinal 15 kDa protein
Gene ID 2172
mRNA Refseq NM_001040442
Protein Refseq NP_001035532
MIM 600422
UniProt ID P51161

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FABP6 Products

Required fields are marked with *

My Review for All FABP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon