Recombinant Human FABP3 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: FABP3-039H
• Product Overview: FABP3 MS Standard C13 and N15-labeled recombinant protein (NP_004093) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 14.9 kDa
• AA Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FABP3 fatty acid binding protein 3 [ Homo sapiens (human) ]
• Official Symbol: FABP3
• Synonyms: FABP3; fatty acid binding protein 3; FABP11; H-FABP; M-FABP; MDGI; O-FABP; fatty acid-binding protein, heart; epididymis secretory sperm binding protein; fatty acid binding protein 11; fatty acid binding protein 3, muscle and heart; heart-type fatty acid-binding protein; mammary-derived growth inhibitor; muscle fatty acid-binding protein
• Gene ID: 2170
• mRNA Refseq: NM_004102
• Protein Refseq: NP_004093
• MIM: 134651
• UniProt ID: P05413