Recombinant Human FABP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FABP1-6128H
• Product Overview: FABP1 MS Standard C13 and N15-labeled recombinant protein (NP_001434) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
• Molecular Mass: 14.2 kDa
• AA Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FABP1 fatty acid binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: FABP1
• Synonyms: FABP1; fatty acid binding protein 1, liver; fatty acid-binding protein, liver; L FABP; fatty acid-binding protein 1; liver-type fatty acid-binding protein; FABPL; L-FABP
• Gene ID: 2168
• mRNA Refseq: NM_001443
• Protein Refseq: NP_001434
• MIM: 134650
• UniProt ID: P07148