Recombinant Human EYA2 protein, His-SUMO-tagged
Cat.No. : | EYA2-2876H |
Product Overview : | Recombinant Human EYA2 protein(O00167)(1-514aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-514aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 72.7 kDa |
AA Sequence : | MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EYA2 eyes absent homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | EYA2 |
Synonyms | EYA2; eyes absent homolog 2 (Drosophila); eyes absent (Drosophila) homolog 2; eyes absent homolog 2; EAB1; MGC10614; |
Gene ID | 2139 |
mRNA Refseq | NM_005244 |
Protein Refseq | NP_005235 |
MIM | 601654 |
UniProt ID | O00167 |
◆ Recombinant Proteins | ||
EYA2-4457HF | Recombinant Full Length Human EYA2 Protein, GST-tagged | +Inquiry |
EYA2-2876H | Recombinant Human EYA2 protein, His-SUMO-tagged | +Inquiry |
EYA2-2910M | Recombinant Mouse EYA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EYA2-6477C | Recombinant Chicken EYA2 | +Inquiry |
EYA2-3101H | Recombinant Human EYA2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EYA2-6491HCL | Recombinant Human EYA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EYA2 Products
Required fields are marked with *
My Review for All EYA2 Products
Required fields are marked with *
0
Inquiry Basket