Tag :	N-GST
ProteinLength :	71-213 aa
Tag :	N-GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence :	VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQR
Purity :	80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	ETV1 ets variant 1 [ Homo sapiens ]
Official Symbol	ETV1
Synonyms	ETV1; ets variant 1; ets variant gene 1; ETS translocation variant 1; ER81; ets-related protein 81; MGC104699; MGC120533; MGC120534; DKFZp781L0674;
Gene ID	2115
mRNA Refseq	NM_001163147
Protein Refseq	NP_001156619
MIM	600541
UniProt ID	P50549

COA

Cat.No. :	ETV1-1275H
Product Overview :	Recombinant Human ETV1 protein(71-213 aa), fused with N-terminal GST tag, was expressed in E. coli.

Recombinant Human ETV1 protein, GST-tagged