Recombinant Human ETS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ETS1-1083H
• Product Overview: ETS1 MS Standard C13 and N15-labeled recombinant protein (NP_005229) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 50.2 kDa
• AA Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ETS1 ETS proto-oncogene 1, transcription factor [ Homo sapiens (human) ]
• Official Symbol: ETS1
• Synonyms: ETS1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); EWSR2, v ets avian erythroblastosis virus E26 oncogene homolog 1; protein C-ets-1; Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; ets protein; ETS 1; FLJ10768; p54; v-ets avian erythroblastosis virus E2 oncogene homolog 1; Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; ETS-1; EWSR2
• Gene ID: 2113
• mRNA Refseq: NM_005238
• Protein Refseq: NP_005229
• MIM: 164720
• UniProt ID: P14921