Recombinant Human ETS1 Protein, His-tagged
Cat.No. : | ETS1-901H |
Product Overview : | Recombinant Human ETS1, transcript variant 2, fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, 1mM EDTA, pH 7.4 |
Molecular Mass : | 33kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDN |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | ETS1 v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) [ Homo sapiens ] |
Official Symbol | ETS1 |
Synonyms | ETS1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); EWSR2, v ets avian erythroblastosis virus E26 oncogene homolog 1; protein C-ets-1; Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; ets protein; ETS 1; FLJ10768; p54; v-ets avian erythroblastosis virus E2 oncogene homolog 1; Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; ETS-1; EWSR2; |
Gene ID | 2113 |
mRNA Refseq | NM_001143820 |
Protein Refseq | NP_001137292 |
MIM | 164720 |
UniProt ID | P14921 |
◆ Recombinant Proteins | ||
ETS1-3527H | Recombinant Human ETS1 Protein, GST-tagged | +Inquiry |
ETS1-872H | Recombinant Human ETS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETS1-1219H | Recombinant Human V-Ets Erythroblastosis Virus E26 Oncogene Homolog 1 (avian), GST-tagged | +Inquiry |
Ets1-2882M | Recombinant Mouse Ets1 Protein, Myc/DDK-tagged | +Inquiry |
ETS1-28335TH | Recombinant Human ETS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETS1-6526HCL | Recombinant Human ETS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ETS1 Products
Required fields are marked with *
My Review for All ETS1 Products
Required fields are marked with *
0
Inquiry Basket