Recombinant Human estrogen receptor 1 Protein, His tagged

• Cat.No.: ESR1-001H
• Product Overview: Recombinant human estrogen receptor 1 Protein (1-116aa) with C-His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-116aa
• Description: This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain.
• Tag: C-His
• Molecular Mass: 13 kDa
• AA Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.5 mg/mL by BCA

Gene Information

• Gene Name: ESR1 estrogen receptor 1 [ Homo sapiens (human) ]
• Official Symbol: ESR1
• Synonyms: ESR1; estrogen receptor 1; ESR; estrogen receptor; Era; NR3A1; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha 3*,4,5,6,7*/822 isoform; estrogen receptor alpha delta 4*,5,6,7*/654 isoform; estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform; estrogen receptor alpha delta 3*,4,5,6,7*/819-2 isoform; estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform; ER; ESRA; DKFZp686N23123
• Gene ID: 2099
• mRNA Refseq: NM_000125
• Protein Refseq: NP_000116
• MIM: 133430
• UniProt ID: P03372