Recombinant Human ERICH4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ERICH4-1400H
• Product Overview: C19orf69 MS Standard C13 and N15-labeled recombinant protein (NP_001123986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ERICH4 (Glutamate Rich 4) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.3 kDa
• AA Sequence: MELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDSLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEEEEDQEPQRKQEEEHLEACPAPHPPDFEMMITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ERICH4 glutamate rich 4 [ Homo sapiens (human) ]
• Official Symbol: ERICH4
• Synonyms: ERICH4; glutamate rich 4; C19orf69; glutamate-rich protein 4
• Gene ID: 100170765
• mRNA Refseq: NM_001130514
• Protein Refseq: NP_001123986
• UniProt ID: A6NGS2