Recombinant Human ERH Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ERH-2364H
• Product Overview: ERH MS Standard C13 and N15-labeled recombinant protein (NP_004441) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: May have a role in the cell cycle.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.3 kDa
• AA Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ERH ERH mRNA splicing and mitosis factor [ Homo sapiens (human) ]
• Official Symbol: ERH
• Synonyms: ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; FLJ27340
• Gene ID: 2079
• mRNA Refseq: NM_004450
• Protein Refseq: NP_004441
• MIM: 601191
• UniProt ID: P84090