Recombinant Human ERBB4 protein, GST-tagged

• Cat.No.: ERBB4-3768H
• Product Overview: Recombinant Human ERBB4 protein(989-1308 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 989-1308 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: GDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ERBB4 v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) [ Homo sapiens ]
• Official Symbol: ERBB4
• Synonyms: ERBB4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); v erb a avian erythroblastic leukemia viral oncogene homolog like 4; receptor tyrosine-protein kinase erbB-4; proto-oncogene-like protein c-ErbB-4; tyrosine kinase-type cell surface receptor HER4; avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; HER4; p180erbB4; MGC138404
• Gene ID: 2066
• mRNA Refseq: NM_001042599
• Protein Refseq: NP_001036064
• MIM: 600543
• UniProt ID: Q15303