Recombinant Human EPO protein
Cat.No. : | EPO-513H |
Product Overview : | Recombinant Human EPO alpha protein was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Protein Length : | 166 |
Description : | Erythropoietin (EPO), a glycoprotein produced primarily by the kidney, is the principal factor that regulates erythropoiesis by stimulating the proliferation and differentiation of erythroid progenitor cells. The production of EPO by kidney cells is increased in response to hypoxia or anemia. Recombinant EPO has been approved for the treatment of anemia associated with chronic renal failure as well as for anemia of AZT treated AIDS patients. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in sodium citrate buffer (1 liter of ddH2O containing 5.9 g of sodium citrate, 5.8 g of sodium chloride and 0.06 g of citric acid). |
Bio-activity : | Fully biologically active when compared to standard. The Specific Activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and is no less than 1.5 × 10⁵ IU/mg. |
Molecular Mass : | Mature human EPO, containing 166 amino acid residues, has a predicted molecular mass of approximately 21 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 36-40 kDa in SDS-PAGE. |
AA Sequence : | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
Endotoxin : | Less than 0.01 EU/μg of rHuEPO-α as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | EPO |
Official Symbol | EPO |
Synonyms | EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142; |
Gene ID | 2056 |
mRNA Refseq | NM_000799 |
Protein Refseq | NP_000790 |
MIM | 133170 |
UniProt ID | P01588 |
◆ Recombinant Proteins | ||
EPO-5397C | Recombinant Cynomolgus monkey EPO protein, His-tagged | +Inquiry |
EPO-100E | Recombinant Equine EPO | +Inquiry |
EPOR-1614H | Recombinant Human Erythropoietin Receptor | +Inquiry |
EPO-517H | Recombinant Human EPO protein | +Inquiry |
EPO-4368B | Recombinant Bovine EPO Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *
0
Inquiry Basket