Recombinant Human EPHB6

• Cat.No.: EPHB6-28625TH
• Product Overview: Recombinant fragment of Human Eph receptor B6 with N-terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Description: Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The ephrin receptor encoded by this gene lacks the kinase activity of most receptor tyrosine kinases and binds to ephrin-B ligands.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in brain. Expressed in non invasive breast carcinoma cell lines (at protein level). Strong expression in brain and pancreas, and weak expression in other tissues, such as heart, placenta, lung, liver, skeletal muscle and kidney. Expressed in bre
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
• Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.Contains 2 fibronectin type-III domains.Contains 1 protein kinase domain.Contains 1 SAM (sterile alpha motif) domain.
• Tag: Non

Gene Information

• Gene Name: EPHB6 EPH receptor B6 [ Homo sapiens ]
• Official Symbol: EPHB6
• Synonyms: EPHB6; EPH receptor B6; EphB6; ephrin type-B receptor 6; HEP
• Gene ID: 2051
• mRNA Refseq: NM_004445
• Protein Refseq: NP_004436
• MIM: 602757
• Uniprot ID: O15197
• Chromosome Location: 7q33-q35
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem
• Function: ATP binding; ephrin receptor activity; nucleotide binding; protein kinase activity; receptor activity