Recombinant Human EPHB6

Cat.No. : EPHB6-28625TH
Product Overview : Recombinant fragment of Human Eph receptor B6 with N-terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The ephrin receptor encoded by this gene lacks the kinase activity of most receptor tyrosine kinases and binds to ephrin-B ligands.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in brain. Expressed in non invasive breast carcinoma cell lines (at protein level). Strong expression in brain and pancreas, and weak expression in other tissues, such as heart, placenta, lung, liver, skeletal muscle and kidney. Expressed in bre
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.Contains 2 fibronectin type-III domains.Contains 1 protein kinase domain.Contains 1 SAM (sterile alpha motif) domain.
Gene Name EPHB6 EPH receptor B6 [ Homo sapiens ]
Official Symbol EPHB6
Synonyms EPHB6; EPH receptor B6; EphB6; ephrin type-B receptor 6; HEP;
Gene ID 2051
mRNA Refseq NM_004445
Protein Refseq NP_004436
MIM 602757
Uniprot ID O15197
Chromosome Location 7q33-q35
Pathway Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem;
Function ATP binding; ephrin receptor activity; nucleotide binding; protein kinase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EPHB6 Products

Required fields are marked with *

My Review for All EPHB6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon