Recombinant Human EPB41L5 protein, GST-tagged
Cat.No. : | EPB41L5-301543H |
Product Overview : | Recombinant Human EPB41L5 (349-445 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly349-Lys445 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GKTEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPSISSAPVPVEIENLPQSPGTDQHDRK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | EPB41L5 erythrocyte membrane protein band 4.1 like 5 [ Homo sapiens ] |
Official Symbol | EPB41L5 |
Synonyms | EPB41L5; erythrocyte membrane protein band 4.1 like 5; band 4.1-like protein 5; BE37; FLJ12957; KIAA1548; YMO1; |
Gene ID | 57669 |
mRNA Refseq | NM_001184937 |
Protein Refseq | NP_001171866 |
MIM | 611730 |
UniProt ID | Q9HCM4 |
◆ Recombinant Proteins | ||
EPB41L5-3360H | Recombinant Human EPB41L5 Protein, GST-tagged | +Inquiry |
EPB41L5-4265HF | Recombinant Full Length Human EPB41L5 Protein, GST-tagged | +Inquiry |
EPB41L5-10441Z | Recombinant Zebrafish EPB41L5 | +Inquiry |
Epb41l5-2841M | Recombinant Mouse Epb41l5 Protein, Myc/DDK-tagged | +Inquiry |
EPB41L5-4632H | Recombinant Human EPB41L5 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPB41L5 Products
Required fields are marked with *
My Review for All EPB41L5 Products
Required fields are marked with *
0
Inquiry Basket