Recombinant Human EP300 Protein, GST-tagged

Description :	This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. [provided by RefSeq, Jul 2008]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.74 kDa
AA Sequence :	PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	EP300 E1A binding protein p300 [ Homo sapiens ]
Official Symbol	EP300
Synonyms	EP300; E1A binding protein p300; histone acetyltransferase p300; KAT3B; p300; p300 HAT; E1A-binding protein, 300kD; E1A-associated protein p300; RSTS2;
Gene ID	2033
mRNA Refseq	NM_001429
Protein Refseq	NP_001420
MIM	602700
UniProt ID	Q09472